PDB entry 6g6s

View 6g6s on RCSB PDB site
Description: crystal structure of human acinus rna recognition motif domain
Deposited on 2018-04-03, released 2018-06-27
The last revision was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptotic chromatin condensation inducer in the nucleus
    Species: Homo sapiens [TaxId:9606]
    Gene: ACIN1, ACINUS, KIAA0670
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKV3 (2-94)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Apoptotic chromatin condensation inducer in the nucleus
    Species: Homo sapiens [TaxId:9606]
    Gene: ACIN1, ACINUS, KIAA0670
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g6sA (A:)
gsgkisnivhisnlvrpftlgqlkellgrtgtlveeafwidkikshcfvtystveeavat
rtalhgvkwpqsnpkflcadyaeqdeldyhrgllv

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6g6sB (B:)
gsgkisnivhisnlvrpftlgqlkellgrtgtlveeafwidkikshcfvtystveeavat
rtalhgvkwpqsnpkflcadyaeqdeldyhrgllv

    Sequence, based on observed residues (ATOM records):
    >6g6sB (B:)
gkisnivhisnlvrpftlgqlkellgrtgtlveeafwidkikshcfvtystveeavatrt
alhgvkwpqsnpkflcadyaeqdeldyhrgl