PDB entry 6g6n

View 6g6n on RCSB PDB site
Description: crystal structure of the computationally designed tako8 protein in c2
Deposited on 2018-04-01, released 2018-11-28
The last revision was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tako8
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G6N
  • Chain 'B':
    Compound: Tako8
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G6N
  • Chain 'C':
    Compound: Tako8
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6G6N
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g6nA (A:)
    gshmgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvw
    diktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvw
    diktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdikgs
    

    Sequence, based on observed residues (ATOM records):
    >6g6nA (A:)
    qslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfnd
    nivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktg
    qslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfnd
    nivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktg
    qslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfnd
    nivvsgsddstvkvwdikg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6g6nB (B:)
    gshmgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvw
    diktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvw
    diktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdikgs
    

    Sequence, based on observed residues (ATOM records):
    >6g6nB (B:)
    slrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndn
    ivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgq
    slrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndn
    ivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgq
    slrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndn
    ivvsgsddstvkvwdikg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6g6nC (C:)
    gshmgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvw
    diktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvw
    diktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavts
    lqfndnivvsgsddstvkvwdikgs
    

    Sequence, based on observed residues (ATOM records):
    >6g6nC (C:)
    slrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndn
    ivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgq
    slrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndn
    ivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndnivvsgsddstvkvwdiktgq
    slrtlqghqsavtslqfndnivvsgsddstvkvwdiktgqslrtlqghqsavtslqfndn
    ivvsgsddstvkvwdikg