PDB entry 6g6k

View 6g6k on RCSB PDB site
Description: The crystal structures of Human MYC:MAX bHLHZip complex
Class: apoptosis
Keywords: Myc/Max, APOPTOSIS
Deposited on 2018-04-01, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MYC, BHLHE39
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01106 (7-93)
      • expression tag (5-6)
  • Chain 'B':
    Compound: Protein max
    Species: Homo sapiens [TaxId:9606]
    Gene: MAX, BHLHD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6kb_
  • Chain 'C':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MYC, BHLHE39
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01106 (7-93)
      • expression tag (6)
  • Chain 'D':
    Compound: Protein max
    Species: Homo sapiens [TaxId:9606]
    Gene: MAX, BHLHD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6kd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6g6kB (B:)
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknht
hqqdiddlkrqnalleqqvrale

    Sequence, based on observed residues (ATOM records): (download) 
    >6g6kB (B:)
ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
ddlkrqnalleqqvra

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >6g6kD (D:)
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknht
hqqdiddlkrqnalleqqvrale

    Sequence, based on observed residues (ATOM records): (download) 
    >6g6kD (D:)
ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
ddlkrqnalleqqvra