PDB entry 6g6j

View 6g6j on RCSB PDB site
Description: The crystal structures of Human MYC:MAX bHLHZip complex
Class: apoptosis
Keywords: Myc/Max, APOPTOSIS
Deposited on 2018-04-01, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MYC, BHLHE39
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6ja_
  • Chain 'B':
    Compound: Protein max
    Species: Homo sapiens [TaxId:9606]
    Gene: MAX, BHLHD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6jb_
  • Chain 'C':
    Compound: myc proto-oncogene protein
    Species: Homo sapiens [TaxId:9606]
    Gene: MYC, BHLHE39
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6jc_
  • Chain 'D':
    Compound: Protein max
    Species: Homo sapiens [TaxId:9606]
    Gene: MAX, BHLHD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g6jd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g6jA (A:)
    mhhhhhheenvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayi
    lsvqaeeqkliseedllrkrreqlkhkleqlrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g6jA (A:)
    thnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeqklisee
    dllrkrreqlkhkleqlrns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g6jB (B:)
    madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknht
    hqqdiddlkrqnalleqqvrale
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g6jB (B:)
    alerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdiddlk
    rqnalleqqvral
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g6jC (C:)
    mhhhhhheenvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayi
    lsvqaeeqkliseedllrkrreqlkhkleqlrns
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g6jC (C:)
    nvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeqkliseedl
    lrkrreqlkhkleqlrns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g6jD (D:)
    madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknht
    hqqdiddlkrqnalleqqvrale
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g6jD (D:)
    rkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdiddlkrqn
    alleqqvral