PDB entry 6g62

View 6g62 on RCSB PDB site
Description: Crystal structure of thioredoxin O2 from Arabidopsis thaliana in oxidized state
Class: oxidoreductase
Keywords: Thioredoxin, Oxidoreductase
Deposited on 2018-03-31, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin O2, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g31020, F17F8.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93VQ9 (21-132)
      • expression tag (18-20)
    Domains in SCOPe 2.08: d6g62a1, d6g62a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6g62A (A:)
mgsshhhhhhssglvprgshmrssfvvlkseaefnsalskardgslpsvfyftaawcgpc
rlispvilelsnkypdvttykvdidegglsnaigklnvsavptlqffkggvkkaeivgvd
vvrlksvmeqlyk

    Sequence, based on observed residues (ATOM records): (download) 
    >6g62A (A:)
shmrssfvvlkseaefnsalskardgslpsvfyftaawcgpcrlispvilelsnkypdvt
tykvdidegglsnaigklnvsavptlqffkggvkkaeivgvdvvrlksvmeqlyk