PDB entry 6g61

View 6g61 on RCSB PDB site
Description: Crystal structure of thioredoxin O1 from Arabidopsis thaliana in oxidized state
Class: oxidoreductase
Keywords: Thioredoxin, oxidoreductase
Deposited on 2018-03-31, released 2018-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin O1, mitochondrial
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g35010, F19I3.24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6g61a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6g61A (A:)
mgsshhhhhhssglvprgshmengvvlvkseeefinamskaqdgslpsvfyftaawcgpc
rfispvivelskqypdvttykvdideggisntisklnitavptlhffkggskkgevvgad
vtklknlmeqlyk

    Sequence, based on observed residues (ATOM records): (download) 
    >6g61A (A:)
ngvvlvkseeefinamskaqdgslpsvfyftaawcgpcrfispvivelskqypdvttykv
dideggisntisklnitavptlhffkggskkgevvgadvtklknlmeqlyk