PDB entry 6g5s

View 6g5s on RCSB PDB site
Description: solution structure of the tpr domain of the cell division coordinator, cpob
Deposited on 2018-03-29, released 2018-08-08
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division coordinator CpoB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: cpoB, ybgF, b0742, JW0732
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45955 (21-145)
      • initiating methionine (0)
      • expression tag (1-20)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g5sA (A:)
mgsshhhhhhssglvprgshmsgnantdynaaialvqdksrqddamvafqnfiknypdst
ylpnanywlgqlnynkgkkddaayyfasvvknypkspkaadamfkvgvimqdkgdtakak
avyqqviskypgtdgakqaqkrlnam