PDB entry 6g5r

View 6g5r on RCSB PDB site
Description: structure of the ub2h domain of e.coli pbp1b in complex with lpob
Deposited on 2018-03-29, released 2019-02-20
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 1b
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: mrcB, pbpF, ponB, b0149, JW0145
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02919 (21-113)
      • initiating methionine (0)
      • expression tag (1-20)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g5rA (A:)
mgsshhhhhhssglvprgshmgrmvnlepdmtisknemvklleatqyrqvskmtrpgeft
vqansiemirrpfdfpdskegqvrarltfdgdhlativnmennrqfgffrldpr