PDB entry 6g5j

View 6g5j on RCSB PDB site
Description: Secreted phospholipase A2 type X in complex with ligand
Class: hydrolase
Keywords: SECRETORY PHOSPHOLIPASE A2 TYPE X sPLA2X sPLA2-X phospholipase enzyme inhibitor complex, HYDROLASE
Deposited on 2018-03-29, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: group 10 secretory phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g5ja_
  • Chain 'B':
    Compound: group 10 secretory phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g5jb_
  • Heterogens: EM8, CA, PEG, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g5jA (A:)
    mgplpvclpimlllllpslllllllpgpgsgeasrilrvhrrgilelagtvgcvgprtpi
    aymkygcfcglgghgqprdaidwcchghdccytraeeagcspkteryswqcvnqsvlcgp
    aenkcqellckcdqeianclaqteynlkylfypqflcepdspkcd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g5jA (A:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g5jB (B:)
    mgplpvclpimlllllpslllllllpgpgsgeasrilrvhrrgilelagtvgcvgprtpi
    aymkygcfcglgghgqprdaidwcchghdccytraeeagcspkteryswqcvnqsvlcgp
    aenkcqellckcdqeianclaqteynlkylfypqflcepdspkcd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g5jB (B:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kcd