PDB entry 6g4z

View 6g4z on RCSB PDB site
Description: crystal structure of murine nf-kappab inducing kinase (nik) in complex with compound 2f
Deposited on 2018-03-28, released 2018-07-04
The last revision was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: MAP3K14, NIK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: MAP3K14, NIK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ELW, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g4zA (A:)
    gsalekvpveeylvhalqgsvssgqahslaslaktwssgsaklqrlgpetednegvllte
    klkpvdyeyreevhwmthqprvgrgsfgevhrmkdkqtgfqcavkkvrlevfrveelvac
    aglssprivplygavregpwvnifmelleggslgqlikqmgclpedralyylgqalegle
    ylhtrrilhgdvkadnvllssdgsraalcdfghalclqpdglgkslltgdyipgtethma
    pevvmgkpcdakvdiwssccmmlhmlngchpwtqyfrgplclkiasepppireippscap
    ltaqaiqeglrkepvhrasamelrrkvgkalqevgglkspwkgeykepr
    

    Sequence, based on observed residues (ATOM records):
    >6g4zA (A:)
    pveeylvhalqgsvssgqahslaslaktwsdnegvllteklkpvdyeyreevhwmthqpr
    vgrgsfgevhrmkdkqtgfqcavkkvrlevfrveelvacaglssprivplygavregpwv
    nifmelleggslgqlikqmgclpedralyylgqalegleylhtrrilhgdvkadnvllss
    dgsraalcdfghalclqslltgdyipgtethmapevvmgkpcdakvdiwssccmmlhmln
    gchpwtqyfrgplclkiasepppireippscapltaqaiqeglrkepvhrasamelrrkv
    gkalqevgglkspwkgeykepr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6g4zB (B:)
    gsalekvpveeylvhalqgsvssgqahslaslaktwssgsaklqrlgpetednegvllte
    klkpvdyeyreevhwmthqprvgrgsfgevhrmkdkqtgfqcavkkvrlevfrveelvac
    aglssprivplygavregpwvnifmelleggslgqlikqmgclpedralyylgqalegle
    ylhtrrilhgdvkadnvllssdgsraalcdfghalclqpdglgkslltgdyipgtethma
    pevvmgkpcdakvdiwssccmmlhmlngchpwtqyfrgplclkiasepppireippscap
    ltaqaiqeglrkepvhrasamelrrkvgkalqevgglkspwkgeykepr
    

    Sequence, based on observed residues (ATOM records):
    >6g4zB (B:)
    pveeylvhalqgsvssgqahslaslaktwsdnegvllteklkpvdyeyreevhwmthqpr
    vgrgsfgevhrmkdkqtgfqcavkkvrlevfrveelvacaglssprivplygavregpwv
    nifmelleggslgqlikqmgclpedralyylgqalegleylhtrrilhgdvkadnvllss
    dgsraalcdfghalclqpdglgkslltgdyipgtethmapevvmgkpcdakvdiwssccm
    mlhmlngchpwtqgplclkiasepppireippscapltaqaiqeglrkepvhrasamelr
    rkvgkalqevgglkspwkgeykepr