PDB entry 6g4o

View 6g4o on RCSB PDB site
Description: Non-aged form of Torpedo californica acetylcholinesterase inhibited by tabun analog NEDPA bound to uncharged reactivator 1
Class: hydrolase
Keywords: acetylcholinesterase, tabun, nerve agent, HYDROLASE
Deposited on 2018-03-28, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g4oa_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g4ob_
  • Heterogens: NAG, ELT, DQ5, CL, PG4, NA, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g4oA (A:)
    addhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwn
    astypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiyggg
    fysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqw
    vhdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsva
    egrrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidge
    ffptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvkls
    vphandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngty
    lyffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfakt
    gnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g4oA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    epskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g4oB (B:)
    addhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwn
    astypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiyggg
    fysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqw
    vhdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsva
    egrrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidge
    ffptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvkls
    vphandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngty
    lyffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfakt
    gnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatac
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g4oB (B:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat