PDB entry 6g4a

View 6g4a on RCSB PDB site
Description: FLN5 (full length)
Class: structural protein
Keywords: filamin, gelation factor, structural protein
Deposited on 2018-03-27, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gelation factor
  Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
  Gene: abpC, DDB_G0269100
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13466 (9-113)
    • initiating methionine (0)
    • expression tag (1-8)
  Domains in SCOPe 2.08: d6g4aa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6g4aA (A:)
  mhhhhhhaskpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevain
  gpdglvvdakvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcieg