PDB entry 6g4a

View 6g4a on RCSB PDB site
Description: FLN5 (full length)
Class: structural protein
Keywords: filamin, gelation factor, structural protein
Deposited on 2018-03-27, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelation factor
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: abpC, DDB_G0269100
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13466 (9-113)
      • initiating methionine (0)
      • expression tag (1-8)
    Domains in SCOPe 2.07: d6g4aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g4aA (A:)
    mhhhhhhaskpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevain
    gpdglvvdakvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcieg