PDB entry 6g48

View 6g48 on RCSB PDB site
Description: Sporosarcina pasteurii urease inhibited by silver
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-03-27, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Urease subunit gamma
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YGY5 (1-99)
  Domains in SCOPe 2.08: d6g48a_
• Chain 'B':
  Compound: urease subunit beta
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41021 (0-121)
  Domains in SCOPe 2.08: d6g48b_
• Chain 'C':
  Compound: urease subunit alpha
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YL32 (0-569)
• Heterogens: EDO, SO4, NI, OH, AG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6g48A (A:)
  mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
  khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6g48B (B:)
  nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
  rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
  ve
  

  
  
• Chain 'C':
  No sequence available.