PDB entry 6g47

View 6g47 on RCSB PDB site
Description: Crystal Structure of Human Adenovirus 52 Short Fiber Knob in Complex with alpha-(2,8)-Trisialic Acid (DP3)
Class: cell adhesion
Keywords: polysialic acid, adenovirus, virolectin, fiber knob, cell attachment, viral entry, carbohydrate, CELL ADHESION
Deposited on 2018-03-26, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fiber-1
    Species: Human adenovirus 52 [TaxId:332179]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g47a_
  • Chain 'B':
    Compound: Fiber-1
    Species: Human adenovirus 52 [TaxId:332179]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g47b_
  • Chain 'C':
    Compound: Fiber-1
    Species: Human adenovirus 52 [TaxId:332179]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0MK70 (Start-208)
      • expression tag (15-21)
  • Heterogens: SIA, MPD, MRD, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g47A (A:)
    mrgshhhhhhgsgsgsgiegrpyngtgsrfnssgaiafgiqtlwtpptsnpnctvytesd
    sllslcltkcgahvlgsvsltgvagtmtnmaetslaieftfddtgkllhsplvnntfsir
    qgdspasnptynalafmpnstlyarggsgeprnnyyvqtylrgnvqrpitltvtfnsaat
    gyslsfkwtavvrekfaapatsfcyiteq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g47A (A:)
    giqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaie
    ftfddtgkllhsplvnntfsirqgdspasnptynalafmpnstlyarggsgeprnnyyvq
    tylrgnvqrpitltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g47B (B:)
    mrgshhhhhhgsgsgsgiegrpyngtgsrfnssgaiafgiqtlwtpptsnpnctvytesd
    sllslcltkcgahvlgsvsltgvagtmtnmaetslaieftfddtgkllhsplvnntfsir
    qgdspasnptynalafmpnstlyarggsgeprnnyyvqtylrgnvqrpitltvtfnsaat
    gyslsfkwtavvrekfaapatsfcyiteq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g47B (B:)
    iqtlwtpptsnpnctvytesdsllslcltkcgahvlgsvsltgvagtmtnmaetslaief
    tfddtgkllhsplvnntfsirqnalafmpnstlyarggsgeprnnyyvqtylrgnvqrpi
    tltvtfnsaatgyslsfkwtavvrekfaapatsfcyiteq
    

  • Chain 'C':
    No sequence available.