PDB entry 6g45

View 6g45 on RCSB PDB site
Description: crystal structure of mavirus major capsid protein
Deposited on 2018-03-26, released 2018-07-04
The last revision was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative major capsid protein
    Species: Cafeteriavirus-dependent mavirus [TaxId:1932923]
    Gene: MV18, Mvrk_gpp18
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative major capsid protein
    Species: Cafeteriavirus-dependent mavirus [TaxId:1932923]
    Gene: MV18, Mvrk_gpp18
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Putative major capsid protein
    Species: Cafeteriavirus-dependent mavirus [TaxId:1932923]
    Gene: MV18, Mvrk_gpp18
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g45A (A:)
    gamgmntppeldtvlqapyaynwptsknvkiasrigipystfqtiqpvsdapnngigqit
    fnqplgnltggaprlrvsftaeikniladsslkdqiglksfpvnrsipvavinmngktft
    sypaqliklhqynadplelallspcsdvdeynkikavsmnnpyrqgtestdsrmsrglgc
    nyayyihpraagstsvkidfvvdealvanptqyknikdpvpfrnlntfkvildgqfkpen
    migiaddvklvagkadfevditgfkinmlvqnwvapleigdipktiiyntplislegnis
    smclntkdpygipgernkhiltthsmamnnvpsmfavmvsqetptkkfapdqlagiigle
    ikvdsdvgifreleqqqlyelsssngynkrfscfsgalangltvadpavaagnkfkeaif
    gagsviffrpsdlglkdynvmananksinmqvqatfvtpeaagtgahyklevfsirdnlt
    ysfedgtfmddltlytpdqllrsplkltddnnklmrvmggsfmgdvmtnfnhmaahpvtk
    tvtkllrnagplkdyagdgtmmgniasvygygkkktttrkkkggeivllgsgkkggkkls
    dkqlhdlrnl
    

    Sequence, based on observed residues (ATOM records):
    >6g45A (A:)
    ntppeldtvlqapyaynwptsknvkiasrigipystfqtiqpvsdapnngigqitfnqpl
    gnltggaprlrvsftaeikniladsslkdqiglksfpvnrsipvavinmngktftsypaq
    liklhqynadplelallspcsdvdeynkikavsmnnpyrqgtestdsrmsrglgcnyayy
    ihpraagstsvkidfvvdealvanptqyknikdpvpfrnlntfkvildgqfkpenmigia
    ddvklvagkadfevditgfkinmlvqnwvapleigdipktiiyntplislegnissmcln
    tkdpygipgernkhiltthsmamnnvpsmfavmvsqetptkkfapdqlagiigleikvds
    dvgifreleqqqlyelsssngynkrfscfsgalangltvadpavaagnkfkeaifgagsv
    iffrpsdlglkdynvmananksinmqvqatfvtpeaagtgahyklevfsirdnltysfed
    gtfmddltlytpdqllrsplklt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6g45B (B:)
    gamgmntppeldtvlqapyaynwptsknvkiasrigipystfqtiqpvsdapnngigqit
    fnqplgnltggaprlrvsftaeikniladsslkdqiglksfpvnrsipvavinmngktft
    sypaqliklhqynadplelallspcsdvdeynkikavsmnnpyrqgtestdsrmsrglgc
    nyayyihpraagstsvkidfvvdealvanptqyknikdpvpfrnlntfkvildgqfkpen
    migiaddvklvagkadfevditgfkinmlvqnwvapleigdipktiiyntplislegnis
    smclntkdpygipgernkhiltthsmamnnvpsmfavmvsqetptkkfapdqlagiigle
    ikvdsdvgifreleqqqlyelsssngynkrfscfsgalangltvadpavaagnkfkeaif
    gagsviffrpsdlglkdynvmananksinmqvqatfvtpeaagtgahyklevfsirdnlt
    ysfedgtfmddltlytpdqllrsplkltddnnklmrvmggsfmgdvmtnfnhmaahpvtk
    tvtkllrnagplkdyagdgtmmgniasvygygkkktttrkkkggeivllgsgkkggkkls
    dkqlhdlrnl
    

    Sequence, based on observed residues (ATOM records):
    >6g45B (B:)
    ntppeldtvlqapyaynwptsknvkiasrigipystfqtiqpvsdapnngigqitfnqpl
    gnltggaprlrvsftaeikniladsslkdqiglksfpvnrsipvavinmngktftsypaq
    liklhqynadplelallspcsdvdeynkikavsmnnpyrqgtestdsrmsrglgcnyayy
    ihpraagstsvkidfvvdealvanptqyknikdpvpfrnlntfkvildgqfkpenmigia
    ddvklvagkadfevditgfkinmlvqnwvapleigdipktiiyntplislegnissmcln
    tkdpygipgernkhiltthsmamnnvpsmfavmvsqetptkkfapdqlagiigleikvds
    dvgifreleqqqlyelsssngynkrfscfsgalangltvadpavaagnkfkeaifgagsv
    iffrpsdlglkdynvmananksinmqvqatfvtpeaagtgahyklevfsirdnltysfed
    gtfmddltlytpdqllrsplklt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6g45C (C:)
    gamgmntppeldtvlqapyaynwptsknvkiasrigipystfqtiqpvsdapnngigqit
    fnqplgnltggaprlrvsftaeikniladsslkdqiglksfpvnrsipvavinmngktft
    sypaqliklhqynadplelallspcsdvdeynkikavsmnnpyrqgtestdsrmsrglgc
    nyayyihpraagstsvkidfvvdealvanptqyknikdpvpfrnlntfkvildgqfkpen
    migiaddvklvagkadfevditgfkinmlvqnwvapleigdipktiiyntplislegnis
    smclntkdpygipgernkhiltthsmamnnvpsmfavmvsqetptkkfapdqlagiigle
    ikvdsdvgifreleqqqlyelsssngynkrfscfsgalangltvadpavaagnkfkeaif
    gagsviffrpsdlglkdynvmananksinmqvqatfvtpeaagtgahyklevfsirdnlt
    ysfedgtfmddltlytpdqllrsplkltddnnklmrvmggsfmgdvmtnfnhmaahpvtk
    tvtkllrnagplkdyagdgtmmgniasvygygkkktttrkkkggeivllgsgkkggkkls
    dkqlhdlrnl
    

    Sequence, based on observed residues (ATOM records):
    >6g45C (C:)
    ntppeldtvlqapyaynwptsknvkiasrigipystfqtiqpvsdapnngigqitfnqpl
    gnltggaprlrvsftaeikniladsslkdqiglksfpvnrsipvavinmngktftsypaq
    liklhqynadplelallspcsdvdeynkikavsmnnpyrqgtestdsrmsrglgcnyayy
    ihpraagstsvkidfvvdealvanptqyknikdpvpfrnlntfkvildgqfkpenmigia
    ddvklvagkadfevditgfkinmlvqnwvapleigdipktiiyntplislegnissmcln
    tkdpygipgernkhiltthsmamnnvpsmfavmvsqetptkkfapdqlagiigleikvds
    dvgifreleqqqlyelsssngynkrfscfsgalangltvadpavaagnkfkeaifgagsv
    iffrpsdlglkdynvmananksinmqvqatfvtpeaagtgahyklevfsirdnltysfed
    gtfmddltlytpdqllrsplklt