PDB entry 6g3z

View 6g3z on RCSB PDB site
Description: Sulfolobus sulfataricus 2-keto-3-deoxygluconate (KDG) aldolase complex with D-KDPG
Class: lyase
Keywords: 2-keto-3-deoxygluconate aldolase, Sulfolobus sulfataricus, 2-Dehydro-3-deoxy-6-phospho-D-gluconate, lyase
Deposited on 2018-03-26, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g3za_
  • Chain 'B':
    Compound: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g3zb_
  • Heterogens: ELE, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g3zA (A:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3zA (A:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g3zB (B:)
    mpeiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlk
    avydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlc
    evsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgs
    dmliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifg
    slssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3zB (B:)
    peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
    vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
    vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
    mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
    lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke