PDB entry 6g3m

View 6g3m on RCSB PDB site
Description: Phosphotriesterase PTE_C23M_4
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-03-26, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434
      • conflict (43)
      • conflict (46)
      • conflict (98)
      • conflict (139)
      • conflict (151)
      • conflict (169)
      • conflict (220)
      • conflict (240)
      • conflict (285)
      • conflict (308-309)
    Domains in SCOPe 2.07: d6g3ma_
  • Heterogens: FMT, ZN, VX, E8N, GOL, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g3mA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraa
    gvrtivdvstfdigrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflre
    iqygiedtgiragiikvatngkatpfqelvlraaaraslatgvpvtthtlasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallg
    nrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvi
    pflrekgvsnetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3mA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
    vrtivdvstfdigrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
    qygiedtgiragiikvatngkatpfqelvlraaaraslatgvpvtthtlasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgvsnetlagitvtnparflspt