PDB entry 6g3g

View 6g3g on RCSB PDB site
Description: crystal structure of edds lyase in complex with succinate
Deposited on 2018-03-25, released 2018-05-16
The last revision was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Lyase
    Species: Chelativorans sp. (strain BNC1) [TaxId:266779]
    Gene: Meso_0564
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SIN, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g3gA (A:)
    mninvpdatrigratgakapefqelydfdaaaltltsavfpydsqihrahvvmlteqgil
    tveesatilsglaqvdelaatdgslrtylpyeaalkrtigsvagkmhigrsrndlanagk
    rmflrdqllrtieavigyreavvhkaadhldtvmvvytqrkeaqpitlghylmaisenla
    knldryrelyarinlcplgaaatagtgwplnrdrtsallgfdglvvnsiegvagwdhvae
    hafvnavflsglsrlaseiqlwstdeyqvaeldasfagtssimpqkknpdslersrkaaf
    aamgplvgiltslnaieyqysaarveleprsidaliaathamtgvvrtlhpnkermrqya
    aenystmtdltdmlvrrvgidyreaheivahvvitaiekgikankigldlvqeaavaqtg
    aginvsaddikdaldpwqnvlrregkgmpapmsvkasiddamaelhkdrawlanatqala
    nakqtladsvqqiiqtdrkylrhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6g3gA (A:)
    vpdatrigratgakapefqelydfdaaaltltsavfpydsqihrahvvmlteqgiltvee
    satilsglaqvdelaatdgslrtylpyeaalkrtigsvagkmhigrsrndlanagkrmfl
    rdqllrtieavigyreavvhkaadhldtvmvvytqrkeaqpitlghylmaisenlaknld
    ryrelyarinlcplgaaatagtgwplnrdrtsallgfdglvvnsiegvagwdhvaehafv
    navflsglsrlaseiqlwstdeyqvaeldasfagtssimpqkknpdslersrkaafaamg
    plvgiltslnaieyqysaarveleprsidaliaathamtgvvrtlhpnkermrqyaaeny
    stmtdltdmlvrrvgidyreaheivahvvitaiekgikankigldlvqeaavaqtgagin
    vsaddikdaldpwqnvlrregkgmpapmsvkasiddamaelhkdrawlanatqalanakq
    tladsvqqiiqtdrkyl