PDB entry 6g3c

View 6g3c on RCSB PDB site
Description: Crystal Structure of JAK2-V617F pseudokinase domain in complex with Compound 2
Class: transferase
Keywords: janus protein kinase, pseudokinase, phosphotransferase, transferase
Deposited on 2018-03-24, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q506Q0 (0-271)
      • engineered mutation (122)
      • engineered mutation (240)
      • engineered mutation (257)
    Domains in SCOPe 2.07: d6g3ca_
  • Chain 'B':
    Compound: Tyrosine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: JAK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q506Q0 (0-271)
      • engineered mutation (122)
      • engineered mutation (240)
      • engineered mutation (257)
    Domains in SCOPe 2.07: d6g3cb_
  • Heterogens: EKT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g3cA (A:)
    fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
    aasmmsklshkhlvlnygvcfcgdenilvqefvkfgsldtylkknkncinilwklevakq
    laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
    pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
    aaelanlinncmdyepdhrpsfraiirdlnsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g3cB (B:)
    fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
    aasmmsklshkhlvlnygvcfcgdenilvqefvkfgsldtylkknkncinilwklevakq
    laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
    pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
    aaelanlinncmdyepdhrpsfraiirdlnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3cB (B:)
    fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
    aasmmsklshkhlvlnygvcenilvqefvkfgsldtylkknkncinilwklevakqlaaa
    mhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeripwvp
    pecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapkaael
    anlinncmdyepdhrpsfraiirdlnsl