PDB entry 6g2u

View 6g2u on RCSB PDB site
Description: Crystal structure of the human glutamate dehydrogenase 2 (hGDH2)
Class: oxidoreductase
Keywords: glutamate, dehydrogenase, OXIDOREDUCTASE
Deposited on 2018-03-23, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate dehydrogenase 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD2, GLUDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2ua1, d6g2ua2
  • Chain 'B':
    Compound: Glutamate dehydrogenase 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD2, GLUDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2ub1, d6g2ub2
  • Chain 'C':
    Compound: Glutamate dehydrogenase 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD2, GLUDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2uc1, d6g2uc2
  • Chain 'D':
    Compound: Glutamate dehydrogenase 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD2, GLUDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2ud1, d6g2ud2
  • Chain 'E':
    Compound: Glutamate dehydrogenase 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD2, GLUDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2ue1, d6g2ue2
  • Chain 'F':
    Compound: Glutamate dehydrogenase 2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: GLUD2, GLUDP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2uf1, d6g2uf2
  • Heterogens: PO4, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g2uA (A:)
    selvadreddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfrdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpea
    dkiflernilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqes
    lerkfgkhggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgld
    lrtaayvnaiekvfkvyseagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2uA (A:)
    eddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsf
    pirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfg
    gakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadty
    astighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfr
    dktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilg
    fpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpeadkifler
    nilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqeslerkfgk
    hggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgldlrtaayv
    naiekvfkvyseag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g2uB (B:)
    selvadreddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfrdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpea
    dkiflernilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqes
    lerkfgkhggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgld
    lrtaayvnaiekvfkvyseagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2uB (B:)
    pnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsfpir
    rddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfggak
    agvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadtyast
    ighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfrdkt
    fvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfpk
    akpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpeadkiflernil
    vipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqeslerkfgkhgg
    tipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgldlrtaayvnai
    ekvfkvyseag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g2uC (C:)
    selvadreddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfrdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpea
    dkiflernilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqes
    lerkfgkhggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgld
    lrtaayvnaiekvfkvyseagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2uC (C:)
    pnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsfpir
    rddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfggak
    agvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadtyast
    ighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfrdkt
    fvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfpk
    akpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpeadkiflernil
    vipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqeslerkfgkhgg
    tipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgldlrtaayvnai
    ekvfkvyseag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g2uD (D:)
    selvadreddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfrdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpea
    dkiflernilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqes
    lerkfgkhggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgld
    lrtaayvnaiekvfkvyseagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2uD (D:)
    eddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsf
    pirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfg
    gakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadty
    astighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfr
    dktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilg
    fpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpeadkifler
    nilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqeslerkfgk
    hggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgldlrtaayv
    naiekvfkvyseagvt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6g2uE (E:)
    selvadreddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfrdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpea
    dkiflernilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqes
    lerkfgkhggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgld
    lrtaayvnaiekvfkvyseagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2uE (E:)
    dpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfrdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpeadkiflerni
    lvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqeslerkfgkhg
    gtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgldlrtaayvna
    iekvfkvyseag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6g2uF (F:)
    selvadreddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcn
    hvlslsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykca
    vvdvpfggakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgerem
    swiadtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsil
    gmtpgfrdktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfkl
    qhgsilgfpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpea
    dkiflernilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqes
    lerkfgkhggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgld
    lrtaayvnaiekvfkvyseagvtft
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2uF (F:)
    eddpnffkmvegffdrgasivedklvkdlrtqeseeqkrnrvrgilriikpcnhvlslsf
    pirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfg
    gakagvkinpknytenelekitrrftmelakkgfigpgvdvpapdmntgeremswiadty
    astighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfr
    dktfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilg
    fpkakpyegsilevdcdilipaatekqltksnaprvkakiiaegangpttpeadkifler
    nilvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhlllsvqeslerkfgk
    hggtipivptaefqdsisgasekdivhsalaytmersarqimhtamkynlgldlrtaayv
    naiekvfkvyseagvt