PDB entry 6g2s

View 6g2s on RCSB PDB site
Description: Crystal structure of FimH in complex with a pentaflourinated biphenyl alpha D-mannoside
Class: cell adhesion
Keywords: type I pilus, catch-bond, cell adhesion, lectin, upec, infection, mannose
Deposited on 2018-03-23, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sa_
  • Chain 'B':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sb_
  • Chain 'C':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sc_
  • Chain 'D':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sd_
  • Chain 'E':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2se_
  • Chain 'F':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sf_
  • Chain 'G':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sg_
  • Chain 'H':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2sh_
  • Chain 'I':
    Compound: Type 1 fimbrin D-mannose specific adhesin
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2si_
  • Heterogens: EJN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sB (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sC (C:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sD (D:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sE (E:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sF (F:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sG (G:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sH (H:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6g2sI (I:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt