PDB entry 6g2r

View 6g2r on RCSB PDB site
Description: Crystal structure of FimH in complex with a tetraflourinated biphenyl alpha D-mannoside
Class: cell adhesion
Keywords: type I pilus, catch-bond, cell adhesion, lectin, upec, infection, mannose
Deposited on 2018-03-23, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Type 1 fimbrin D-mannose specific adhesin
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: fimH, b4320, JW4283
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-157)
  Domains in SCOPe 2.08: d6g2ra_
• Chain 'B':
  Compound: Type 1 fimbrin D-mannose specific adhesin
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: fimH, b4320, JW4283
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-157)
  Domains in SCOPe 2.08: d6g2rb_
• Heterogens: EJK, SO4, EPE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6g2rA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6g2rB (B:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt