PDB entry 6g2n

View 6g2n on RCSB PDB site
Description: Crystal structure of human cytosolic 5'(3')-deoxyribonucleotidase in complex with the inhibitor PB-PAU
Class: hydrolase
Keywords: 5'-nucleotidase, dephosphorylation, phosphorylation, HAD-like, mitochondria, HYDROLASE-HYDROLASE INHIBITOR complex, HYDROLASE
Deposited on 2018-03-23, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'(3')-deoxyribonucleotidase, cytosolic type
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C, DNT1, UMPH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2na_
  • Chain 'B':
    Compound: 5'(3')-deoxyribonucleotidase, cytosolic type
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C, DNT1, UMPH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2nb_
  • Heterogens: MG, O84, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g2nA (A:)
    snaasarsvrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpd
    ladkvasvyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwv
    eqhlgpqfveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlppt
    rrrllswsdnwreildskrgaaqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2nA (A:)
    svrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpdladkvas
    vyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwveqhlgpq
    fveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlpptrrrllsw
    sdnwreildskr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g2nB (B:)
    snaasarsvrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpd
    ladkvasvyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwv
    eqhlgpqfveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlppt
    rrrllswsdnwreildskrgaaqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2nB (B:)
    svrvlvdmdgvladfeagllrgfrrrfpeephvpleqrrgflareqyralrpdladkvas
    vyeapgffldlepipgaldavremndlpdtqvfictspllkyhhcvgekyrwveqhlgpq
    fveriiltrdktvvlgdlliddkdtvrgqeetpswehilftcchnrhlvlpptrrrllsw
    sdnwreildskr