PDB entry 6g27

View 6g27 on RCSB PDB site
Description: x-ray structure of nsd3-pwwp1 in complex with compound 5
Deposited on 2018-03-22, released 2019-06-26
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase NSD3
    Species: Homo sapiens [TaxId:9606]
    Gene: NSD3, WHSC1L1, DC28
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EHE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g27A (A:)
    stgvkfqvgdlvwskvgtypwwpcmvssdpqlevhtkintrgareyhvqffsnqperawv
    hekrvreykghkqyeellaeatkqasnhsekqkirkprpqreraqwdigiahaekalkmt
    reerieqytfiyidkq
    

    Sequence, based on observed residues (ATOM records):
    >6g27A (A:)
    vkfqvgdlvwskvgtypwwpcmvssdpqlevhtkintrgareyhvqffsnqperawvhek
    rvreykghkqyeellaekirkprpqreraqwdigiahaekalkmtreerieqytfiyid