PDB entry 6g1n

View 6g1n on RCSB PDB site
Description: crystal structure of the burkholderia pseudomallei antitoxin hicb
Deposited on 2018-03-21, released 2018-10-31
The last revision was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitoxin HicB
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS0391
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63NA5 (1-End)
      • initiating methionine (0)
  • Chain 'B':
    Compound: antitoxin HicB
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS0391
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63NA5 (1-End)
      • initiating methionine (0)
  • Chain 'C':
    Compound: antitoxin HicB
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS0391
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63NA5 (1-134)
      • initiating methionine (0)
  • Chain 'D':
    Compound: antitoxin HicB
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS0391
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63NA5 (1-134)
      • initiating methionine (0)
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g1nA (A:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealnegkkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6g1nA (A:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6g1nB (B:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealnegkkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6g1nB (B:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6g1nC (C:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealnegkkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6g1nC (C:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealnegk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6g1nD (D:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealnegkkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6g1nD (D:)
    mmefpiavhkddgsvygvtvpdipgvhswgetiddaikntreaivghvetlielgedvef
    tcstveelvakpeyagavwalvsvdlsqldskperinvsiprfvlhkidayvasrhetrs
    gflaraalealnegk