PDB entry 6g1l

View 6g1l on RCSB PDB site
Description: mitf/clearbox structure
Deposited on 2018-03-21, released 2019-02-06
The last revision was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: microphthalmia-associated transcription factor
    Species: Mus musculus [TaxId:10090]
    Gene: Mitf, Bw, Mi, Vit
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CLEAR-box
    Species: Mus musculus, synthetic [TaxId:10090]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6g1lA (A:)
gamanikreltacifptesearalakerqkkdnhnlierrrrfnindrikelgtlipksn
dpdmrwnkgtilkasvdyirklqreqqrakdlenrqkklehanrhlllrvqelemqarah
g

    Sequence, based on observed residues (ATOM records):
    >6g1lA (A:)
akerqkkdnhnlierrrrfnindrikelgtlipksndpdmrwnkgtilkasvdyirklqr
eqqrakdlenrqkklehan

  • Chain 'B':
    No sequence available.