PDB entry 6g1e

View 6g1e on RCSB PDB site
Description: BEAT Fc with improved heterodimerization (Q3A-D84.4Q)
Class: immune system
Keywords: Antibody, TCR, Bispecific, Heterodimer, IMMUNE SYSTEM
Deposited on 2018-03-21, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin heavy constant gamma 1,Immunoglobulin heavy constant gamma 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
    • Uniprot P01860
      • engineered mutation (126)
      • engineered mutation (143)
      • engineered mutation (145)
      • engineered mutation (149)
      • engineered mutation (171)
      • engineered mutation (184)
      • engineered mutation (186)
      • engineered mutation (188)
      • engineered mutation (190)
    Domains in SCOPe 2.07: d6g1ea1, d6g1ea2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (126)
      • engineered mutation (128)
      • engineered mutation (130)
      • engineered mutation (143)
      • engineered mutation (145)
      • engineered mutation (149)
      • engineered mutation (173)
      • engineered mutation (176)
      • engineered mutation (178)
      • engineered mutation (180)
      • engineered mutation (184)
      • engineered mutation (186)
      • engineered mutation (188)
      • engineered mutation (190)
    Domains in SCOPe 2.07: d6g1eb1, d6g1eb2
  • Heterogens: NAG, BMA, MAN, GAL, FUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g1eA (A:)
    dkthtcppcpapeaaggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvd
    gvevhnaktkpreeqynstfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktk
    gqprepavytlppsreemtknqvklvclvtgfypsdiavewessgqpennyyttppmlds
    dgsfslvswlnvdksrwqqgnifscsvmhealhnrftqkslslspgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g1eA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevqfkwyvdgvevhnaktkpreeqy
    nstfrvvsvltvlhqdwlngkeykckvsnkalpapiektisktkgqprepavytlppsre
    emtknqvklvclvtgfypsdiavewessgqpennyyttppmldsdgsfslvswlnvdksr
    wqqgnifscsvmhealhnrftqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g1eB (B:)
    dkthtcppcpapeaaggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepevatfppsrdeltknqvtlvclvtgfypsdiavewesngqpennyktdpplles
    qgsfalssrlrvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g1eB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepevatfppsrd
    eltknqvtlvclvtgfypsdiavewesngqpennyktdppllesqgsfalssrlrvdksr
    wqqgnvfscsvmhealhnhytqkslsl