PDB entry 6g16

View 6g16 on RCSB PDB site
Description: Structure of the human RBBP4:MTA1(464-546) complex showing loop exchange
Class: transcription
Keywords: WD40, corepressor, metastasis, TRANSCRIPTION
Deposited on 2018-03-20, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g16a_
  • Chain 'B':
    Compound: metastasis-associated protein mta1
    Species: Homo sapiens [TaxId:9606]
    Gene: MTA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g16c_
  • Chain 'D':
    Compound: metastasis-associated protein mta1
    Species: Homo sapiens [TaxId:9606]
    Gene: MTA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g16e_
  • Chain 'F':
    Compound: metastasis-associated protein mta1
    Species: Homo sapiens [TaxId:9606]
    Gene: MTA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Histone-binding protein RBBP4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBBP4, RBAP48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g16g_
  • Chain 'H':
    Compound: metastasis-associated protein mta1
    Species: Homo sapiens [TaxId:9606]
    Gene: MTA1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g16A (A:)
    madkeaafddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkd
    fsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieik
    inhegevnrarympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkeg
    yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
    slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
    wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspedae
    dgppellfihgghtakisdfswnpnepwvicsvsednimqvwqmaeniyndedpegsvdp
    egqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g16A (A:)
    daveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlg
    thtsdeqnhlviasvqlpndgefggfgsvsgkieieikinhegevnrarympqnpciiat
    ktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhti
    clwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnnt
    skpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifq
    vqwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfihgghtakisdfsw
    npnepwvicsvsednimqvwqmaeniynd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g16C (C:)
    madkeaafddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkd
    fsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieik
    inhegevnrarympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkeg
    yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
    slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
    wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspedae
    dgppellfihgghtakisdfswnpnepwvicsvsednimqvwqmaeniyndedpegsvdp
    egqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g16C (C:)
    daveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlg
    thtsdeqnhlviasvqlpndgefggfgsvsgkieieikinhegevnrarympqnpciiat
    ktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhti
    clwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnnt
    skpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifq
    vqwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfihgghtakisdfsw
    npnepwvicsvsednimqvwqmaeniynd
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6g16E (E:)
    madkeaafddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkd
    fsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieik
    inhegevnrarympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkeg
    yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
    slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
    wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspedae
    dgppellfihgghtakisdfswnpnepwvicsvsednimqvwqmaeniyndedpegsvdp
    egqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g16E (E:)
    daveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlg
    thtsdeqnhlviasvqlpndgefggfgsvsgkieieikinhegevnrarympqnpciiat
    ktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhti
    clwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnnt
    skpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifq
    vqwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfihgghtakisdfsw
    npnepwvicsvsednimqvwqmaeniynd
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6g16G (G:)
    madkeaafddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkd
    fsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvsgkieieik
    inhegevnrarympqnpciiatktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkeg
    yglswnpnlsghllsasddhticlwdisavpkegkvvdaktiftghtavvedvswhllhe
    slfgsvaddqklmiwdtrsnntskpshsvdahtaevnclsfnpysefilatgsadktval
    wdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlnvwdlskigeeqspedae
    dgppellfihgghtakisdfswnpnepwvicsvsednimqvwqmaeniyndedpegsvdp
    egqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g16G (G:)
    daveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlg
    thtsdeqnhlviasvqlpndgefggfgsvsgkieieikinhegevnrarympqnpciiat
    ktpssdvlvfdytkhpskpdpsgecnpdlrlrghqkegyglswnpnlsghllsasddhti
    clwdisavpkegkvvdaktiftghtavvedvswhllheslfgsvaddqklmiwdtrsnnt
    skpshsvdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifq
    vqwsphnetilassgtdrrlnvwdlskigeeqspedaedgppellfihgghtakisdfsw
    npnepwvicsvsednimqvwqmaeniynd
    

  • Chain 'H':
    No sequence available.