PDB entry 6g15

View 6g15 on RCSB PDB site
Description: Crystal structure of pppGpp bound RbgA from S. aureus
Class: RNA binding protein
Keywords: cpGTPase, RNA BINDING PROTEIN
Deposited on 2018-03-20, released 2018-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome biogenesis GTPase A
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: SAUSA300_1136
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6g15a_
  • Chain 'B':
    Compound: Ribosome biogenesis GTPase A
    Species: Staphylococcus aureus (strain USA300) [TaxId:367830]
    Gene: SAUSA300_1136
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6g15b_
  • Heterogens: C1Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g15A (A:)
    mghhhhhhviqwypghmakakrevseqlkkvdvvfelvdaripyssrnpmidevinqkpr
    vvilnkkdmsnlnemskweqffidkgyypvsvdakhgknlkkveaaaikataekfereka
    kglkprairamivgipnvgkstlinklakrsiaqtgnkpgvtkqqqwikvgnalqlldtp
    gilwpkfedeevgkklsltgaikdsivhldevaiyglnfliqndlarlkshynievpeda
    eiiawfdaigkkrglirrgneidyeavieliiydirnakignycfdifkdmteelandan
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g15A (A:)
    viqwypghmakakrevseqlkkvdvvfelvdaripyssrnpmidevinqkprvvilnkkd
    msnlnemskweqffidkgyypvsvdakhglkkveaaaikataekferekakglkpraira
    mivgipnvgkstlinklakrsignkpgvtkqqqwikvgnalqlldtpgilwpkfedeevg
    kklsltgaikdsivhldevaiyglnfliqndlarlkshynievpedaeiiawfdaigkkr
    glirrgneidyeavieliiydirnakignycfdifkdmteelandan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g15B (B:)
    mghhhhhhviqwypghmakakrevseqlkkvdvvfelvdaripyssrnpmidevinqkpr
    vvilnkkdmsnlnemskweqffidkgyypvsvdakhgknlkkveaaaikataekfereka
    kglkprairamivgipnvgkstlinklakrsiaqtgnkpgvtkqqqwikvgnalqlldtp
    gilwpkfedeevgkklsltgaikdsivhldevaiyglnfliqndlarlkshynievpeda
    eiiawfdaigkkrglirrgneidyeavieliiydirnakignycfdifkdmteelandan
    n
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g15B (B:)
    viqwypghmakakrevseqlkkvdvvfelvdaripyssrnpmidevinqkprvvilnkkd
    msnlnemskweqffidkgyypvsvdakhgknlkkveaaaikataekferekakglkprai
    ramivgipnvgkstlinklakrsignkpgvtkqqqwikvgnalqlldtpgilwpkfedee
    vgkklsltgaikdsivhldevaiyglnfliqndlarlkshynievpedaeiiawfdaigk
    krglirrgneidyeavieliiydirnakignycfdifkdmteelandan