PDB entry 6g0v

View 6g0v on RCSB PDB site
Description: Human Galectin-3 in complex with a TF tumor-associated antigen mimetic
Class: cell adhesion
Keywords: Galectin-3, Thomsen-Friedenreich, tumour antigen, cancer, TF-mimetic, CELL ADHESION
Deposited on 2018-03-19, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Galectin-3
  Species: Homo sapiens [TaxId:9606]
  Gene: LGALS3, MAC2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17931 (1-137)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6g0va1, d6g0va2
• Heterogens: EGZ, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6g0vA (A:)
  mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
  cntkldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
  klgisgdidltsasytmi