PDB entry 6g0j

View 6g0j on RCSB PDB site
Description: Inactive Fe-PP1
Class: hydrolase
Keywords: Phosphatase, Iron, oxidative stress, cell cycle, HYDROLASE
Deposited on 2018-03-18, released 2018-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-09, with a file datestamp of 2019-01-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6g0ja_
  • Heterogens: FE, MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g0jA (A:)
    gmsdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleapl
    kicgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenff
    llrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspd
    lqsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkh
    dldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
    dknkgkygqfsglnpggrpitpprnsakakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g0jA (A:)
    lnldsiigrllevgknvqlteneirglclksreiflsqpilleleaplkicgdihgqyyd
    llrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhecasin
    riygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqirrimr
    ptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicrahqvv
    edgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp