PDB entry 6g0b

View 6g0b on RCSB PDB site
Description: Crystal Structure of a GH8 xylotriose complex from Teredinibacter Turnerae
Class: hydrolase
Keywords: Xylanse, complex, carbohydrate, hydrolase
Deposited on 2018-03-16, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 8 domain protein
    Species: Teredinibacter turnerae (strain ATCC 39867 / T7901) [TaxId:377629]
    Gene: TERTU_4506
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g0ba_
  • Heterogens: XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g0bA (A:)
    gpaagavatgeyrnlfaeigkseidiqrkideafqhlfygdakdaavyyqaggnengpla
    yvydvnsndvrsegmsygmmitvqmdkkaefdaiwnwaktymyqdspthpafgyfawsmr
    rdgvanddmpapdgeeyfvtalyfaaarwgngegifnyqqeadtilsrmrhrqvitgptn
    rgvmtatnlfhpeeaqvrftpdinnadhtdasyhlpsfyeiwarvapqedrafwakaadv
    srdyfakaahpvtaltpdygnfdgtpwaaswrpesvdfrydawrsvmnwsmdyawwgkds
    gaparsdkllaffetqegkmnhlysldgkplgggptlglismnataamaatdprwhnfve
    klwqqqpptgqyryydgvlylmallhcageykawipdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g0bA (A:)
    gavatgeyrnlfaeigkseidiqrkideafqhlfygdakdaavyyqaggnengplayvyd
    vnsndvrsegmsygmmitvqmdkkaefdaiwnwaktymyqdspthpafgyfawsmrrdgv
    anddmpapdgeeyfvtalyfaaarwgngegifnyqqeadtilsrmrhrqvitgptnrgvm
    tatnlfhpeeaqvrftpdinnadhtdasyhlpsfyeiwarvapqedrafwakaadvsrdy
    fakaahpvtaltpdygnfdgtpwaaswrpesvdfrydawrsvmnwsmdyawwgkdsgapa
    rsdkllaffetqegkmnhlysldgkplgggptlglismnataamaatdprwhnfveklwq
    qqpptgqyryydgvlylmallhcageykawipd