PDB entry 6g04

View 6g04 on RCSB PDB site
Description: nmr solution structure of yeast tsr2(1-152) in complex with s26a(100- 119)
Deposited on 2018-03-16, released 2018-09-19
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pre-rRNA-processing protein TSR2
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: TSR2, YLR435W
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q06672 (4-155)
    • expression tag (0-3)
• Chain 'B':
  Compound: 40S ribosomal protein S26-A
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: RPS26A, RPS26, YGL189C, G1355
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39938 (6-25)
    • expression tag (0-5)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6g04A (A:)
  sgshmstqyidetafvqaeqgktnlmfsdekqqarfelgvsmviykwdaldvavenswgg
  pdsaekrdwitgivvdlfknekvvdaalieetllyamidefetnveddsalpiavevini
  yndcfnlnynkveklylewqekqrtkkskrvvhieg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >6g04B (B:)
  sgsqhmrprfnrenkvspadaakkal