PDB entry 6g03

View 6g03 on RCSB PDB site
Description: nmr solution structure of yeast tsr2(1-152)
Deposited on 2018-03-16, released 2018-09-19
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-rRNA-processing protein TSR2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TSR2, YLR435W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06672 (4-155)
      • expression tag (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6g03A (A:)
    sgshmstqyidetafvqaeqgktnlmfsdekqqarfelgvsmviykwdaldvavenswgg
    pdsaekrdwitgivvdlfknekvvdaalieetllyamidefetnveddsalpiavevini
    yndcfnlnynkveklylewqekqrtkkskrvvhieg