PDB entry 6fzv

View 6fzv on RCSB PDB site
Description: Crystal structure of the metalloproteinase enhancer PCPE-1 bound to the procollagen C propeptide trimer (short)
Class: structural protein
Keywords: collagen, structural protein
Deposited on 2018-03-15, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen alpha-1(III) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02461 (Start-255)
      • variant (142)
      • conflict (156)
  • Chain 'B':
    Compound: Collagen alpha-1(III) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02461 (Start-255)
      • variant (142)
      • conflict (156)
  • Chain 'C':
    Compound: Collagen alpha-1(III) chain
    Species: Homo sapiens [TaxId:9606]
    Gene: COL3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02461 (Start-255)
      • variant (142)
      • conflict (156)
  • Chain 'D':
    Compound: Procollagen C-endopeptidase enhancer 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PCOLCE, PCPE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fzvd1, d6fzvd2
  • Heterogens: CA, FLC, CL

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fzvD (D:)
    aplaqtpnytrpvflcggdvkgesgyvasegfpnlyppnkeciwtitvpegqtvslsfrv
    fdlelhpacrydalevfagsgtsgqrlgrfcgtfrpaplvapgnqvtlrmttdegtggrg
    fllwysgratsgtehqfcggrlekaqgtlttpnwpesdyppgiscswhiiappdqvialt
    fekfdlepdtycrydsvsvfngavsddsrrlgkfcgdavpgsissegnellvqfvsdlsv
    tadgfsasyktlprgtaaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fzvD (D:)
    pvflcggdvkgesgyvasegfpnlyppnkeciwtitvpegqtvslsfrvfdlelhpacry
    dalevfagsgtsgqrlgrfcgtfrpaplvapgnqvtlrmttdegtggrgfllwysgrafc
    ggrlekaqgtlttpnwpesdyppgiscswhiiappdqvialtfekfdlepdtycrydsvs
    vfngavsddsrrlgkfcgdavpgsissegnellvqfvsdlsvtadgfsasyktlpr