PDB entry 6fzo

View 6fzo on RCSB PDB site
Description: smurfp-y56f mutant
Deposited on 2018-03-15, released 2018-10-17
The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Smurfp
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FZO
  • Chain 'B':
    Compound: Smurfp
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FZO (0-End)
  • Chain 'C':
    Compound: Smurfp
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FZO (0-End)
  • Chain 'D':
    Compound: Smurfp
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FZO
  • Heterogens: SO4, EDO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fzoA (A:)
    mktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwfl
    hlitfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanet
    apyfdyiikamshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fzoA (A:)
    ktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwflh
    litfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedaneta
    pyfdyiikamshh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fzoB (B:)
    mktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwfl
    hlitfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanet
    apyfdyiikamshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fzoB (B:)
    mktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwfl
    hlitfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanet
    apyfdyiikamsh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6fzoC (C:)
    mktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwfl
    hlitfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanet
    apyfdyiikamshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fzoC (C:)
    mktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwfl
    hlitfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanet
    apyfdyiikamshhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6fzoD (D:)
    mktseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwfl
    hlitfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanet
    apyfdyiikamshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fzoD (D:)
    tseqrvniatlltenkkkivdkasqdlwrrhpdliapggiafsqrdralclrdfgwflhl
    itfcllagdkgpiesiglisiremynslgvpvpammesirclkeaslslldeedanetap
    yfdyiikamsh