PDB entry 6fzg

View 6fzg on RCSB PDB site
Description: PPAR gamma mutant complex
Class: transcription
Keywords: nuclear receptor, TRANSCRIPTION
Deposited on 2018-03-14, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (1-275)
      • initiating methionine (0)
      • engineered mutation (60)
    Domains in SCOPe 2.07: d6fzga_
  • Heterogens: EDK, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fzgA (A:)
    mqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    mkfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdly