PDB entry 6fzb

View 6fzb on RCSB PDB site
Description: aada in complex with atp, magnesium and streptomycin
Deposited on 2018-03-14, released 2018-06-13
The last revision was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptomycin 3''-adenylyltransferase
    Species: SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM STR. LT2 [TaxId:99287]
    Gene: aadA, STM1264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPX9 (Start-261)
      • expression tag (264-265)
  • Chain 'B':
    Compound: streptomycin 3''-adenylyltransferase
    Species: SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM STR. LT2 [TaxId:99287]
    Gene: aadA, STM1264
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPX9 (Start-261)
      • expression tag (264-265)
  • Heterogens: SRY, MG, ATP, CL, PEG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fzbA (A:)
    mtlsippsiqcqteaacrlitrvtgdtlraihlygsavagglkpnsdidllvticqplte
    aqratlmqellalssppgasaekralevtvvlysqlvpwcfppsremqfgewlredicqg
    iyepaqqdwdmvllitqiletsiplkgeraerlftpapaaqllkalrypldlwqstadvq
    gdeyhivltlariwytlstgrftskdaaadwllpqlpedyaatlraaqreylgleqqdwh
    illpavvrfvdfakahiptqftkghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fzbA (A:)
    lsippsiqcqteaacrlitrvtgdtlraihlygsavagglkpnsdidllvticqplteaq
    ratlmqellalssppgasaekralevtvvlysqlvpwcfppsremqfgewlredicqgiy
    epaqqdwdmvllitqiletsiplkgeraerlftpapaaqllkalrypldlwqstadvqgd
    eyhivltlariwytlstgrftskdaaadwllpqlpedyaatlraaqreylgleqqdwhil
    lpavvrfvdfakahiptqfthh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fzbB (B:)
    mtlsippsiqcqteaacrlitrvtgdtlraihlygsavagglkpnsdidllvticqplte
    aqratlmqellalssppgasaekralevtvvlysqlvpwcfppsremqfgewlredicqg
    iyepaqqdwdmvllitqiletsiplkgeraerlftpapaaqllkalrypldlwqstadvq
    gdeyhivltlariwytlstgrftskdaaadwllpqlpedyaatlraaqreylgleqqdwh
    illpavvrfvdfakahiptqftkghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fzbB (B:)
    tlsippsiqcqteaacrlitrvtgdtlraihlygsavagglkpnsdidllvticqpltea
    qratlmqellalssppgasaekralevtvvlysqlvpwcfppsremqfgewlredicqgi
    yepaqqdwdmvllitqiletsiplkgeraerlftpapaaqllkalrypldlwqstadvqg
    deyhivltlariwytlstgrftskdaaadwllpqlpedyaatlraaqreylgleqqdwhi
    llpavvrfvdfakahiptqfthh