PDB entry 6fz4

View 6fz4 on RCSB PDB site
Description: Structure of GluK1 ligand-binding domain in complex with N-(7-fluoro-2,3-dioxo-6-(trifluoromethyl)-3,4-dihydroquinoxalin-1(2H)-yl)-2-hydroxybenzamide at 1.85 A resolution
Class: membrane protein
Keywords: Kainate receptor ligand-binding domain, GluK1-S1S2, membrane protein
Deposited on 2018-03-14, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor ionotropic, kainate 1,Glutamate receptor ionotropic, kainate 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grik1, Glur5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22756 (Start-115)
      • variant (33)
      • linker (116-117)
    • Uniprot P22756 (118-End)
    Domains in SCOPe 2.07: d6fz4a_
  • Heterogens: GOL, SO4, EC8, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fz4A (A:)
    ganrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgk
    ygaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpi
    dsaddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrv
    lttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqee
    gklhmmkekwwrgngcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fz4A (A:)
    rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
    qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
    ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
    dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
    hmmkekwwrg