PDB entry 6fz2

View 6fz2 on RCSB PDB site
Description: Human N-myristoyltransferase (NMT1) with Myristoyl-CoA and inhibitor bound
Class: transferase
Keywords: protein-ligand complex, TRANSFERASE
Deposited on 2018-03-13, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fz2a1, d6fz2a2
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NMT1, NMT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fz2b1, d6fz2b2
  • Heterogens: 31A, MYA, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fz2A (A:)
    mgsshhhhhhssgrenlyfqgrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlp
    qgftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcg
    vrvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhl
    egifqavytagvvlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetp
    ktaglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenange
    vtdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnal
    dlmenktfleklkfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fz2A (A:)
    syqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytl
    lnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihi
    ydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcr
    ywhrslnprklievkfshnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylk
    qfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnkslkaaysf
    ynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylynwk
    cpsmgaekvglvlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fz2B (B:)
    mgsshhhhhhssgrenlyfqgrsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlp
    qgftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcg
    vrvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhl
    egifqavytagvvlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetp
    ktaglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenange
    vtdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnal
    dlmenktfleklkfgigdgnlqyylynwkcpsmgaekvglvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fz2B (B:)
    syqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytl
    lnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihi
    ydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcr
    ywhrslnprklievkfshmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqfh
    ltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaays
    fynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylynw
    kcpsmgaekvglvlq