PDB entry 6fyw

View 6fyw on RCSB PDB site
Description: Structure of B/Brisbane/60/2008 Influenza Hemagglutinin in complex with SD83
Class: viral protein
Keywords: Influenza, single domain antibody, hemagglutinin, VIRAL PROTEIN
Deposited on 2018-03-12, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: INFLUENZA B VIRUS (B/BRISBANE/60/2008) [TaxId:604436]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fywa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: INFLUENZA B VIRUS (B/BRISBANE/60/2008) [TaxId:604436]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Single domain antibody SD83
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYW (0-128)
  • Heterogens: NAG, BMA, MAN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fywA (A:)
    drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtetrgklcpkclnc
    tdldvalgrpkctgkipsarvsilhevrpvtsgcfpimhdrtkirqlpnllrgyehirls
    thnvinaenapggpykigtsgscpnitngngffatmawavpkndknktatnpltievpyi
    ctegedqitvwgfhsdnetqmaklygdskpqkftssangvtthyvsqiggfpnqtedggl
    pqsgrivvdymvqksgktgtityqrgillpqkvwcasgrskvikgslpligeadclheky
    gglnkskpyytgehakaigncpiwvktplklangtkyrppakllker
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fywA (A:)
    tgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtetrgklcpkclnctdld
    valgrpkctgkipsarvsilhevrpvtsgcfpimhdrtkirqlpnllrgyehirlsthnv
    inaenapggpykigtsgscpnitngngffatmawavpkndknktatnpltievpyicteg
    edqitvwgfhsdnetqmaklygdskpqkftssangvtthyvsqiggfpnqtedgglpqsg
    rivvdymvqksgktgtityqrgillpqkvwcasgrskvikgslpligeadclhekyggln
    kskpyytgehakaigncpiwvktplklangtkyrpp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.