PDB entry 6fyu

View 6fyu on RCSB PDB site
Description: Structure of H7(A/Shanghai/2/2013) Influenza Hemagglutinin in complex SD36
Class: viral protein
Keywords: Influenza, single domain antibody, hemagglutinin, Viral protein
Deposited on 2018-03-12, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemaggluinin HA1
    Species: Influenza A virus (A/pigeon/Wuxi/0405007G/2013(H7N9)) [TaxId:1560294]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyua_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/pigeon/Wuxi/0405007G/2013(H7N9)) [TaxId:1560294]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyub_
  • Chain 'C':
    Compound: Single domain antibody SD36
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYU (0-121)
    Domains in SCOPe 2.07: d6fyuc_
  • Chain 'D':
    Compound: Hemaggluinin HA1
    Species: Influenza A virus (A/pigeon/Wuxi/0405007G/2013(H7N9)) [TaxId:1560294]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyud_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/pigeon/Wuxi/0405007G/2013(H7N9)) [TaxId:1560294]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyue_
  • Chain 'F':
    Compound: Single domain antibody SD36
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYU (0-121)
    Domains in SCOPe 2.07: d6fyuf_
  • Chain 'G':
    Compound: Hemaggluinin HA1
    Species: Influenza A virus (A/pigeon/Wuxi/0405007G/2013(H7N9)) [TaxId:1560294]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyug_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/pigeon/Wuxi/0405007G/2013(H7N9)) [TaxId:1560294]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyuh_
  • Chain 'I':
    Compound: Single domain antibody SD36
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYU (Start-121)
    Domains in SCOPe 2.07: d6fyui_
  • Heterogens: NAG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fyuA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fyuB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvsgrl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fyuC (C:)
    evqlvesggglvqaggslklscaasgrtyamgwfrqapgkerefvahinalgtrtyysds
    vkgrftisrdnaknteylemnnlkpedtavyyctaqgqwraapvavaaeyefwgqgtqvt
    vs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fyuD (D:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuD (D:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeip
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fyuE (E:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvsgrl
    vprxx
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuE (E:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fyuF (F:)
    evqlvesggglvqaggslklscaasgrtyamgwfrqapgkerefvahinalgtrtyysds
    vkgrftisrdnaknteylemnnlkpedtavyyctaqgqwraapvavaaeyefwgqgtqvt
    vs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fyuG (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuG (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeip
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fyuH (H:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvsgrl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuH (H:)
    gaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqf
    elidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervk
    rqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6fyuI (I:)
    evqlvesggglvqaggslklscaasgrtyamgwfrqapgkerefvahinalgtrtyysds
    vkgrftisrdnaknteylemnnlkpedtavyyctaqgqwraapvavaaeyefwgqgtqvt
    vs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyuI (I:)
    vqlvesggglvqaggslklscaasgrtyamgwfrqapgkerefvahinalgtrtyysdsv
    kgrftisrdnaknteylemnnlkpedtavyyctaqgqwraapvavaaeyefwgqgtqvtv
    s