PDB entry 6fyt

View 6fyt on RCSB PDB site
Description: Structure of H1 (A/solomon Islands/3/06) Influenza Hemagglutinin in complex with SD38
Class: viral protein
Keywords: Influenza, single domain antibody, hemagglutinin, VIRAL PROTEIN
Deposited on 2018-03-12, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7Y8I1
      • conflict (3)
      • conflict (46)
    Domains in SCOPe 2.07: d6fyta_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fytb_
  • Chain 'I':
    Compound: Single domain antibody SD38
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYT (0-123)
    Domains in SCOPe 2.07: d6fyti_
  • Heterogens: NAG, FUC, BMA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fytA (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncs
    vagwilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfei
    fpkesswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlw
    gvhhppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepg
    dtiifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhp
    vtigecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fytA (A:)
    gdticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fytB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekid
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fytB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fytI (I:)
    evqlvesggglvqpggslrlscavsisifdiyamdwyrqapgkqrdlvatsfrdgstnya
    dsvkgrftisrdnakntlylqmnslkpedtavylchvslyrdplgvaggmgvywgkgalv
    tvss