PDB entry 6fyq

View 6fyq on RCSB PDB site
Description: The crystal structure of a new transaminase from the marine bacterium Virgibacillus
Class: transferase
Keywords: Omega-amino acid-pyruvate aminotransferase, Virgibacillus pantothenticus, TRANSFERASE
Deposited on 2018-03-12, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine transaminase
    Species: Virgibacillus pantothenticus [TaxId:1473]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYQ
    Domains in SCOPe 2.07: d6fyqa_
  • Heterogens: PLP, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fyqA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdhpftmrslteldkkhfihpfssiqeqqh
    kgakvimkegdgiyltdvtgktyidgvsslwnvnvghgrvelaeaaaqqmkkmafssafs
    tfshepairlaekiasitpeglnavfftsggsesndsavklvrhywkiqgkpnkrkiisl
    krsyhgvaaastsvtgipefwgmaghmmtdflhvdthynntteqavqslcqaieeagpet
    iaaffaepvqgaggviippedyflrirevcnaygilfvadevitgfgrtgkmfgienwdv
    ipdvmtfakgvtsgyfplggvvvsdpihevlkeksvgtlfhgftysghptaaavalknia
    iikeerlvenskrmgdallhglkkvknrleivgdvrfvgllgavelmqnpatnkpfssnl
    qvapkviealhelgvicrsvtydhtniiclappliinqkqvdklveviyeailkvqqqlg
    ikae
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyqA (A:)
    rslteldkkhfihpfssiqeqqhkgakvimkegdgiyltdvtgktyidgvsslwnvnvgh
    grvelaeaaaqqmkkmafssafstfshepairlaekiasitpeglnavfftsggsesnds
    avklvrhywkiqgkpnkrkiislkrsyhgvaaastsvtgipefwgmaghmmtdflhvdth
    ynntteqavqslcqaieeagpetiaaffaepvqgaggviippedyflrirevcnaygilf
    vadevitgfgrtgkmfgienwdvipdvmtfakgvtsgyfplggvvvsdpihevlkeksvg
    tlfhgftysghptaaavalkniaiikeerlvenskrmgdallhglkkvknrleivgdvrf
    vgllgavelmqnpatnkpfssnlqvapkviealhelgvicrsvtydhtniiclappliin
    qkqvdklveviyeailkvqqqlg