PDB entry 6fyl

View 6fyl on RCSB PDB site
Description: X-ray structure of CLK2-KD(136-496)/CX-4945 at 1.95A
Class: transferase
Keywords: splicing, phosphotransferase, transferase
Deposited on 2018-03-12, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein kinase CLK2
    Species: Homo sapiens [TaxId:9606]
    Gene: CLK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fyla_
  • Heterogens: 3NG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fylA (A:)
    gpssrraksveddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrggarvalk
    iiknvekykeaarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellglstfdf
    lkdnnylpypihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltynlekkr
    dersvkstavrvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsigciife
    yyvgftlfqthdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsagryvre
    nckplrryltseaeehhqlfdliesmleyepakrltlgealqhpffarlraeppnklwds
    srd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fylA (A:)
    eddaeghliyhvgdwlqeryeivstlgegtfgrvvqcvdhrrggarvalkiiknvekyke
    aarleinvlekinekdpdnknlcvqmfdwfdyhghmcisfellglstfdflkdnnylpyp
    ihqvrhmafqlcqavkflhdnklthtdlkpenilfvnsdyeltynlekkrdersvkstav
    rvvdfgsatfdhehhstivstrhyrapevilelgwsqpcdvwsigciifeyyvgftlfqt
    hdnrehlammerilgpipsrmirktrkqkyfyrgrldwdentsagryvrenckplrrylt
    seaeehhqlfdliesmleyepakrltlgealqhpffarlr