PDB entry 6fyj

View 6fyj on RCSB PDB site
Description: Cytochrome P450 peroxygenase CYP152K6 in complex with Myristic Acid
Class: oxidoreductase
Keywords: heme, cytochrome p450, peroxygenase, cyp152k6, myristic acid, oxidoreductase
Deposited on 2018-03-12, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty-acid peroxygenase
    Species: Bacillus methanolicus [TaxId:1471]
    Gene: cypC, BMMGA3_06595
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fyja_
  • Heterogens: HEM, MYR, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fyjA (A:)
    gsmsninqmpreegidstwrlmeegymyilnrrhsfnsdifetrllgkkaicmggkeaae
    ifydtekfkrkdaapnrvvqtlfgkngvqaldgqthkhrkemfmsimspdelekltditk
    kqweiavdkweqmdkvilyeeakeimcrtacqwagvpvqenevkrltknlgamfesaaav
    glkhwlgrharnyeeiwieelidrvrdgkvnppenttlhkfswyrdlegnlldtetaave
    vinilrpivaiaifinfialalhhypeekeklksgdkkysqmfvqevrrfypffpfvval
    vkkdftwkgykfeegtltlldlygtnhdpeiwknpdvfspdrfakwegspfsfipqgggd
    yfmghrcagewvtievmkvsldyltnrmdyevpdqdlsfsmasmpsiphskvviknvkkr
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fyjA (A:)
    sninqmpreegidstwrlmeegymyilnrrhsfnsdifetrllgkkaicmggkeaaeify
    dtekfkrkdaapnrvvqtlfgkngvqaldgqthkhrkemfmsimspdelekltditkkqw
    eiavdkweqmdkvilyeeakeimcrtacqwagvpvqenevkrltknlgamfesaaavglk
    hwlgrharnyeeiwieelidrvrdgkvnppenttlhkfswyrdlegnlldtetaavevin
    ilrpivaiaifinfialalhhypeekeklksgdkkysqmfvqevrrfypffpfvvalvkk
    dftwkgykfeegtltlldlygtnhdpeiwknpdvfspdrfakwgspfsfipqgggdyfmg
    hrcagewvtievmkvsldyltnrmdyevpdqdlsfsmasmpsiphskvviknvkkri