PDB entry 6fy5

View 6fy5 on RCSB PDB site
Description: Crystal structure of the macro domain of human macroh2a2
Class: DNA binding protein
Keywords: macro domain, histone variant, DNA BINDING PROTEIN
Deposited on 2018-03-10, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: core histone macro-h2a.2
    Species: Homo sapiens [TaxId:9606]
    Gene: H2AFY2, MACROH2A2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0M6 (3-197)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6fy5a1, d6fy5a2
  • Chain 'B':
    Compound: core histone macro-h2a.2
    Species: Homo sapiens [TaxId:9606]
    Gene: H2AFY2, MACROH2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fy5b_
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fy5A (A:)
    agmgpgdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkale
    kaggkefletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleeti
    knclsaaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllf
    dsesigiyvqemakldak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fy5B (B:)
    agmgpgdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkale
    kaggkefletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleeti
    knclsaaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllf
    dsesigiyvqemakldak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fy5B (B:)
    gdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkalekaggk
    efletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleetikncls
    aaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllfdsesi
    giyvqemakldak