PDB entry 6fy3

View 6fy3 on RCSB PDB site
Description: Crystal structure of a V2-directed, RV144 vaccine-like antibody from HIV-1 infection, CAP228-3D, bound to a heterologous V2 peptide
Class: immune system
Keywords: Fab, HIV-1 Envelope V1V2, IMMUNE SYSTEM
Deposited on 2018-03-10, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CAP228-3D Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV5-51
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY3 (0-End)
  • Chain 'L':
    Compound: CAP228-3D Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV6-57
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY3 (0-End)
    Domains in SCOPe 2.07: d6fy3l1, d6fy3l2
  • Chain 'P':
    Compound: CAP45 V2 peptide
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY3
  • Chain 'X':
    Compound: CAP228-3D Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV5-51
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY3 (0-End)
  • Chain 'Y':
    Compound: CAP228-3D Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV6-57
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY3 (0-End)
    Domains in SCOPe 2.07: d6fy3y1, d6fy3y2
  • Chain 'Z':
    Compound: CAP45 V2 peptide
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fy3L (L:)
    nfmltqphsvsespgktvtisctrssgsiasdyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydmtnhnwvfgggtkltvlgqpkaaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fy3L (L:)
    nfmltqphsvsespgktvtisctrssgsiasdyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydmtnhnwvfgggtkltvlgqpkaaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshrsyscqvthegstvektvap
    

  • Chain 'P':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >6fy3Y (Y:)
    nfmltqphsvsespgktvtisctrssgsiasdyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydmtnhnwvfgggtkltvlgqpkaaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fy3Y (Y:)
    nfmltqphsvsespgktvtisctrssgsiasdyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydmtnhnwvfgggtkltvlgqpkaaps
    vtlfpatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeq
    wkshrsyscqvthegstvektv
    

  • Chain 'Z':
    No sequence available.