PDB entry 6fy1

View 6fy1 on RCSB PDB site
Description: Crystal structure of a V2p-reactive RV144 vaccine-like antibody, CAP228-16H, in complex with a scaffolded autologous V1V2
Class: immune system
Keywords: Fab, HIV-1 Envelope V1V2, IMMUNE SYSTEM
Deposited on 2018-03-10, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: CAP228 Autologous Scaffolded V1V2
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENVELOPE
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY1
  • Chain 'H':
    Compound: CAP228-16H Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV5-51
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY1 (0-End)
  • Chain 'L':
    Compound: CAP228-16H Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV3-21
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY1
    Domains in SCOPe 2.07: d6fy1l1, d6fy1l2
  • Chain 'X':
    Compound: CAP228 Autologous Scaffolded V1V2
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENVELOPE
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY1 (0-End)
  • Chain 'Y':
    Compound: CAP228-16H Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHV5-51
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY1
  • Chain 'Z':
    Compound: CAP228-16H Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV3-21
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY1

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fy1L (L:)
    syeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiper
    fsgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvlsqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fy1L (L:)
    yeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiperf
    sgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvlsqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.