PDB entry 6fxu

View 6fxu on RCSB PDB site
Description: Crystal structure of human transthyretin mutant T119M at pH 5.5
Class: transport protein
Keywords: Amyloid, Gatekeeper, Aggregation, Stability, TRANSPORT PROTEIN
Deposited on 2018-03-09, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6fxua_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6fxub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fxuA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystma
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxuA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fxuB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystma
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fxuB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsrrytiaallspysystmavvtnp